DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment InR and Cad96Ca

DIOPT Version :9

Sequence 1:NP_001138093.1 Gene:InR / 42549 FlyBaseID:FBgn0283499 Length:2144 Species:Drosophila melanogaster
Sequence 2:NP_651349.1 Gene:Cad96Ca / 43026 FlyBaseID:FBgn0022800 Length:773 Species:Drosophila melanogaster


Alignment Length:326 Identity:116/326 - (35%)
Similarity:176/326 - (53%) Gaps:39/326 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly  1362 DDWEVLRENIIQLAPLGQGSFGMVYEGILKSFPPNGVDRECAIKTVNENATDRERTNFLSEASVM 1426
            |.||..|..:.....||:|:||.|:.....:...|......|:||:.|:||:.:|.:.|||..||
  Fly   461 DRWEFPRYRLKFFNILGEGAFGQVWRCEATNINGNEGITTVAVKTLKESATEVDRKDLLSELEVM 525

  Fly  1427 KEFDTY-HVVRLLGVCSRGQPALVVMELMKKGDLKSYLRAHRPEERDEAMMTYLNRIGVTGNVQP 1490
            |..:.: :||.|||.|:...|..|::|.:.:|.|::|||:.|.|..             .||   
  Fly   526 KSLEPHINVVHLLGCCTDKDPTFVILEYVNRGKLQTYLRSSRAERH-------------YGN--- 574

  Fly  1491 PTYGR--------IYQMAIEIADGMAYLAAKKFVHRDLAARNCMVADDLTVKIGDFGMTRDIYET 1547
             |:|:        :.....::|.||.||.::..:||||||||.::.||.|.|:.|||..||:..:
  Fly   575 -THGKSNVLTSCDLTSFMYQVAKGMDYLTSRGIIHRDLAARNILITDDHTCKVADFGFARDVITS 638

  Fly  1548 DYYRKGTKGLLPVRWMPPESLRDGVYSSASDVFSFGVVLWEMATLAAQPYQGLSNEQVLRYVIDG 1612
            ..|.:.::|.||:|||..|||.|.::|..||::|||:::||:.||.:.||.|:|...|:|.|.||
  Fly   639 KIYERKSEGKLPIRWMATESLYDNIFSVKSDIWSFGILMWEIVTLGSTPYPGISAADVMRKVRDG 703

  Fly  1613 GVMERPENCPDFLHKLMQRCWHHRSSARPSFLDIIAYLEPQCPNSQFKEVSFYHSEAGLQHREKE 1677
            ..:|:||:|...|:.:|..||.|....||.|.:||..|:           ...|:|  :.:.|.|
  Fly   704 YRLEKPEHCRRELYNIMYYCWSHDPQERPLFAEIIQMLD-----------KLLHTE--MDYIELE 755

  Fly  1678 R 1678
            |
  Fly   756 R 756

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
InRNP_001138093.1 Recep_L_domain 356..465 CDD:279382
Furin-like 512..645 CDD:279142
FU 545..592 CDD:238021
Recep_L_domain 663..781 CDD:279382
FN3 1224..1302 CDD:238020
PTKc_InsR_like 1364..1652 CDD:173625 110/296 (37%)
Pkinase_Tyr 1371..1650 CDD:285015 106/287 (37%)
Cad96CaNP_651349.1 Cadherin_repeat 65..164 CDD:206637
STYKc 470..741 CDD:214568 106/287 (37%)
PTKc 474..742 CDD:270623 106/284 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455345
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24416
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.