DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment InR and Nrk

DIOPT Version :9

Sequence 1:NP_001138093.1 Gene:InR / 42549 FlyBaseID:FBgn0283499 Length:2144 Species:Drosophila melanogaster
Sequence 2:NP_477255.1 Gene:Nrk / 36445 FlyBaseID:FBgn0020391 Length:724 Species:Drosophila melanogaster


Alignment Length:303 Identity:116/303 - (38%)
Similarity:179/303 - (59%) Gaps:23/303 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly  1365 EVLRENIIQLAPLGQGSFGMVYEGILKSFPPNGVDRECAIKTVNENATDRERTNFLSEASVMKEF 1429
            |..|.:|:.:..||||:||.|::.......|:..|...|:|.:.::|:|:.:.:|..||.::.||
  Fly   435 EYPRGDIVYVRSLGQGAFGRVFQARAPGLVPDQEDLLVAVKMLKDDASDQMQMDFEREACLLAEF 499

  Fly  1430 DTYHVVRLLGVCSRGQPALVVMELMKKGDLKSYLRAHRPEERDEAMMTYLNRIGVTGNVQPPTYG 1494
            |..::|||||||:.|:|..::.|.|..|||..:|||..|....:|                ||..
  Fly   500 DHPNIVRLLGVCALGRPMCLLFEYMAPGDLSEFLRACSPYATHQA----------------PTQD 548

  Fly  1495 R-------IYQMAIEIADGMAYLAAKKFVHRDLAARNCMVADDLTVKIGDFGMTRDIYETDYYRK 1552
            |       :.|||..||.||.||:.:||||||||.|||::.:.:.|||.|||::..||..|||:.
  Fly   549 RLQLNELHLLQMAANIAAGMLYLSERKFVHRDLATRNCLINEHMAVKIADFGLSHKIYLQDYYKG 613

  Fly  1553 GTKGLLPVRWMPPESLRDGVYSSASDVFSFGVVLWEMATLAAQPYQGLSNEQVLRYVIDGGVMER 1617
            .....:|:||||.||:....:|..|||:::|:.|||:.:.|.|||.||::|:|::|:.:|.|:..
  Fly   614 DENDFIPIRWMPLESILYNKFSLESDVWAYGICLWEVFSFALQPYFGLTHEEVIKYIKEGNVLGC 678

  Fly  1618 PENCPDFLHKLMQRCWHHRSSARPSFLDIIAYLEPQCPNSQFK 1660
            |:|.|..::.||:|||:.:.|.||.|.:|...::.....|:.|
  Fly   679 PDNTPLSVYALMRRCWNRKPSERPGFAEINHCIQHSIAESECK 721

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
InRNP_001138093.1 Recep_L_domain 356..465 CDD:279382
Furin-like 512..645 CDD:279142
FU 545..592 CDD:238021
Recep_L_domain 663..781 CDD:279382
FN3 1224..1302 CDD:238020
PTKc_InsR_like 1364..1652 CDD:173625 114/293 (39%)
Pkinase_Tyr 1371..1650 CDD:285015 112/285 (39%)
NrkNP_477255.1 CRD_FZ 67..212 CDD:295308
KR 217..299 CDD:214527
PTKc_Musk 435..713 CDD:133181 114/293 (39%)
Pkinase_Tyr 441..707 CDD:285015 111/281 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455347
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24416
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.