DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment InR and Drl-2

DIOPT Version :9

Sequence 1:NP_001138093.1 Gene:InR / 42549 FlyBaseID:FBgn0283499 Length:2144 Species:Drosophila melanogaster
Sequence 2:NP_001286371.1 Gene:Drl-2 / 36436 FlyBaseID:FBgn0033791 Length:648 Species:Drosophila melanogaster


Alignment Length:555 Identity:126/555 - (22%)
Similarity:219/555 - (39%) Gaps:144/555 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly  1142 KELPPNQTHFVFEKLRHFTRYAIFV-----------------VACREEIPSEKLRDTSFKKSLCS 1189
            |:|..:..|..|....:.:...:|:                 :|...:.|::.      ||| ||
  Fly   211 KQLRQDSLHTSFTTAAYGSHQNVFIRLDPLGRPPSATGSYATIASLNKYPADS------KKS-CS 268

  Fly  1190 DYDTVFQTTKRKKFADIVMDLKVDLEHANNTESPVRVRWTPPVDPNGEIVTYEVAYKLQKPDQVE 1254
            .:|....:.....:|..::.:        |.|......::.|.......::|..:.:|.:|..:.
  Fly   269 IFDRFRSSPTPTPYATALLPM--------NLEQTAETIYSKPESICPSRISYYASSQLTQPCSLS 325

  Fly  1255 EKKCIPAADFNQTAGYLIKLNEGLYSFRVRANSIAGYGDFTEVEHIKVEPPPSYAKVFFWLLGIG 1319
            ..|.|                        |:|   |.|:.|.                    |.|
  Fly   326 TPKSI------------------------RSN---GNGNCTS--------------------GSG 343

  Fly  1320 LAFLIVSLFGYV-------CYLHKRKVPSNDLHMNTEVNPFYASMQYIPDDWEVLRENIIQLAPL 1377
                .:||||.:       ...|..| .:..|...|.|.|  .::.|         |.:::    
  Fly   344 ----SLSLFGGIPTGSTITMASHGEK-GNQRLRRITSVQP--GALSY---------EELVK---- 388

  Fly  1378 GQGSFGMVYEGILKSFPPNGVDRECAIKTVNENATDRERTNFLSEASVMKEFDTYHVVR-LLGVC 1441
             :|:||.:|.|.|      |...|..:|||.:.|:..:....|.:||::......|::. ||...
  Fly   389 -EGTFGRIYAGKL------GESCEALVKTVIDGASLTQVACLLQDASLLIGVSHQHILAPLLANT 446

  Fly  1442 SRGQPALVVMELMKKGDLKSYLRAHRPEERDEAMMTYLNRIGVTGNVQPPTYGRIYQMAIEIADG 1506
            ....|..:......||:||.||:..|  |...|:.|                .::.:..:.|..|
  Fly   447 ELPGPPEIAYPHPSKGNLKMYLQKSR--ESSTALST----------------RQLVEFGLHITKG 493

  Fly  1507 MAYLAAKKFVHRDLAARNCMVADDLTVKIGDFGMTRDIYETDYYRKGTKGLLPVRWMPPESLRDG 1571
            :|||.:...||:|:|.|||.:.::..|||.|..::||::..||...|.....|::|:..|||:..
  Fly   494 LAYLHSLGIVHKDIATRNCYLDEESYVKICDSALSRDLFPDDYDCLGDNENRPLKWLSLESLQKR 558

  Fly  1572 VYSSASDVFSFGVVLWEMATLAAQPYQGLSNEQVLRYVIDGGVMERPENCPDFLHKLMQRCWHHR 1636
            ||::..||::.||..||:.|||..|::.:...::..|:..|..:|:|.||||....:|..|||..
  Fly   559 VYATQGDVWALGVTYWELVTLAQMPHEEVDIFELTNYLAAGFRLEQPVNCPDEFFTVMNCCWHCE 623

  Fly  1637 SSARPSFLDIIAYLEPQCPNSQFKEVSFYHSEAGL 1671
            :..||:...:::||:.            :|::.|:
  Fly   624 AKQRPTPSQLLSYLQD------------FHADLGM 646

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
InRNP_001138093.1 Recep_L_domain 356..465 CDD:279382
Furin-like 512..645 CDD:279142
FU 545..592 CDD:238021
Recep_L_domain 663..781 CDD:279382
FN3 1224..1302 CDD:238020 11/77 (14%)
PTKc_InsR_like 1364..1652 CDD:173625 84/288 (29%)
Pkinase_Tyr 1371..1650 CDD:285015 81/279 (29%)
Drl-2NP_001286371.1 WIF 37..156 CDD:280237
PTK_Ryk 373..644 CDD:270639 89/322 (28%)
STYKc 389..637 CDD:214568 81/271 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24416
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.