DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment InR and dnt

DIOPT Version :9

Sequence 1:NP_001138093.1 Gene:InR / 42549 FlyBaseID:FBgn0283499 Length:2144 Species:Drosophila melanogaster
Sequence 2:NP_001260567.1 Gene:dnt / 35207 FlyBaseID:FBgn0024245 Length:584 Species:Drosophila melanogaster


Alignment Length:586 Identity:134/586 - (22%)
Similarity:234/586 - (39%) Gaps:135/586 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly  1148 QTHFVFEKLRHFTRYAI-FVVACREEIPSEKLRDTSFKKSLCSDYDTVFQTTKRKKFADIVMDLK 1211
            :.::|.|  .|...||: |:|    .:|: .::|.||.....:.....:.........:::....
  Fly    65 EVYYVRE--GHINNYALNFIV----PVPA-NVKDISFTWQSLAGRGLPYSINVVSSDQEVLPRPA 122

  Fly  1212 VDLEHANNTESPVRVRWTPPVDPNGEIVTYEVAYKLQKPDQVEEKKC--IPAADFNQTAGYLIKL 1274
            :::.|:.  |.|..::            |:.:|.           ||  :.||:.:.|....:.|
  Fly   123 INVSHSG--EIPTTIQ------------TWSIAL-----------KCSGLKAAEVDVTVSLEVVL 162

  Fly  1275 NEGLYSFR---VRANSIAGYGDFTEVEHIKVEPPPSYAKVFFWLLGIGLAFLIVSL---FGYVCY 1333
            |..|.:..   .|...|....|..|.....|:.|.....|.  |...||..|:|.:   .|.||.
  Fly   163 NRSLNNVTHLVFRRKKICLMNDSAEDLSEDVDDPQLLETVM--LPPTGLITLVVGVSVAMGSVCL 225

  Fly  1334 L-----------HKRK---------VPSNDLHMNTE-----------------VNPFYASM---- 1357
            |           :||:         ..|:...:||.                 :.|.:.|.    
  Fly   226 LLMIAYCVKGAANKRQHHQHGGQPMRTSSFQRLNTHPPCQSSMGSAAYMTPSIIAPIHGSSLPRK 290

  Fly  1358 ------QYIPDDWEVLRENIIQL----------APLGQGSFGMVYEGILKSFPPNGVDRECAIKT 1406
                  |..|::   |...|.:|          :.|.:|:||.||.|....      .::..:||
  Fly   291 VPVSVEQQHPEE---LHRRISELTVERCRVRLSSLLQEGTFGRVYRGTYND------TQDVLVKT 346

  Fly  1407 VNENATDRERTNFLSEASVMKEFDTYHVVRLLGVC--SRGQPALVVMELMKKGDLKSYLRAHRPE 1469
            |.::|:..:....|.|..::.......::.:|||.  ....|.::...|....:||.:|      
  Fly   347 VAQHASQMQVLLLLQEGMLLYGASHPGILSVLGVSIEDHTTPFVLYPALNNTRNLKQFL------ 405

  Fly  1470 ERDEAMMTYLNRIGVTGNVQPPTYGRIYQMAIEIADGMAYLAAKKFVHRDLAARNCMVADDLTVK 1534
             .|.|....:..|            :|..||.:::..:.:|.:...||:|:|.|||::.|.|.||
  Fly   406 -LDPACARTVTTI------------QIVMMASQLSMALDHLHSHGVVHKDIATRNCVIDDQLRVK 457

  Fly  1535 IGDFGMTRDIYETDYYRKGTKGLLPVRWMPPESLRDGVYSSASDVFSFGVVLWEMATLAAQPYQG 1599
            :.|..::||::.:||...|.....||:||..|:|:...:|.|||.::|||::||:.|.|.|||..
  Fly   458 LSDSSLSRDLFPSDYNCLGDSENRPVKWMSLEALQHKQFSEASDSWAFGVLMWELCTSAKQPYAE 522

  Fly  1600 LSNEQVLRYVIDGGVMERPENCPDFLHKLMQRCWHHRSSARPSFLDIIAYLEPQCPNSQFKEVSF 1664
            :...::..|:.||..:.:|.||||.|..:|..||....:.||:|..:     ..|.:..:.:::.
  Fly   523 VDPFEMEHYLKDGYRLAQPFNCPDELFTIMAYCWALLPAERPTFAQL-----QSCLSEFYSQITR 582

  Fly  1665 Y 1665
            |
  Fly   583 Y 583

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
InRNP_001138093.1 Recep_L_domain 356..465 CDD:279382
Furin-like 512..645 CDD:279142
FU 545..592 CDD:238021
Recep_L_domain 663..781 CDD:279382
FN3 1224..1302 CDD:238020 14/82 (17%)
PTKc_InsR_like 1364..1652 CDD:173625 83/299 (28%)
Pkinase_Tyr 1371..1650 CDD:285015 82/290 (28%)
dntNP_001260567.1 WIF 46..182 CDD:128745 26/148 (18%)
PKc_like 310..580 CDD:304357 82/299 (27%)
Pkinase_Tyr 317..573 CDD:285015 80/285 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455354
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24416
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.