DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15498 and Cfap161

DIOPT Version :9

Sequence 1:NP_650974.1 Gene:CG15498 / 42548 FlyBaseID:FBgn0038892 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_083611.2 Gene:Cfap161 / 75556 MGIID:1922806 Length:303 Species:Mus musculus


Alignment Length:305 Identity:89/305 - (29%)
Similarity:131/305 - (42%) Gaps:70/305 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYGPGVKVGNWLETALSEEMRMSEMKKRRESGNLLLDRTRAVYDRFYQGTVLGPPQD-VLAFG-V 63
            :|||||::|||.|....||.||....::||.|.||:.|.|.|.....:...|...:| .:.:| .
Mouse     5 VYGPGVRMGNWNEDVYLEEERMRHFLEKREKGELLIQRNRRVKKNILRPMQLSVSEDGYVHYGDK 69

  Fly    64 VVQIRPVKI-------------GVC------RQQVSDQNLVLSVVITQEGLHRNCKTINEMCDLT 109
            |:.:.|.::             .:|      :.|:||.                   :...|.::
Mouse    70 VIIVNPDQVLGEEAGKFMRGDLSLCMSPDEVKAQLSDD-------------------LEIPCGVS 115

  Fly   110 VAPSPRPALRNSFRIVSPNEDD-RTGQYLAYGEKFRL---QALEPADEPMYVFSGPKRLNLSLPV 170
            ...:..|..||:|.|:|...:. ..||.:.||:.|.|   ..||  .:.:|:.|..:.|..|   
Mouse   116 AVQTIAPMGRNTFTILSDGANSCEMGQVVVYGQNFCLGIAAGLE--GKMLYLTSDHRTLLKS--- 175

  Fly   171 EKAFFTTKNG--EVTLPLGLVSHKNCGPSARVPTSHTHFFCAHKDPDLRFESEGKTIPVHNPLVI 233
                 :.|:|  |||| ...|:|.||..:|.:            ||.||.|.||..:..:..:||
Mouse   176 -----SLKSGLQEVTL-TDEVTHLNCWQAAFL------------DPQLRLEYEGFPVRANEKIVI 222

  Fly   234 VHAVTNRNLAV-ENVLANTLFGPEFQVSVQTYKNVYKRETWKNLW 277
            .|..|||.||| .|:...|.||.|.:|...||.:.:|.|..||.|
Mouse   223 YHRHTNRALAVHRNLFLRTYFGKEMEVVAHTYLDSHKVEKPKNQW 267



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849882
Domainoid 1 1.000 96 1.000 Domainoid score I7329
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12605
Inparanoid 1 1.050 96 1.000 Inparanoid score I5030
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56406
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008126
OrthoInspector 1 1.000 - - otm42373
orthoMCL 1 0.900 - - OOG6_104967
Panther 1 1.100 - - LDO PTHR24274
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5257
SonicParanoid 1 1.000 - - X6078
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1312.930

Return to query results.
Submit another query.