DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15498 and CG17234

DIOPT Version :9

Sequence 1:NP_650974.1 Gene:CG15498 / 42548 FlyBaseID:FBgn0038892 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster


Alignment Length:99 Identity:21/99 - (21%)
Similarity:33/99 - (33%) Gaps:26/99 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 CGPSAR-----VPTSHTHFFCAHKDPDLRFESEGKTIPVHNPL------------VIVHAVTNRN 241
            ||.|..     |..:|    |...:...|.:.:|..:...:.|            :|:|.....:
  Fly    52 CGGSIYSENIIVTAAH----CFFDEEGNRLDDQGYQVRAGSALTDSNGTLVDVAALIIHEEYAFD 112

  Fly   242 LAVENVLANTLFGP-EFQVSVQ----TYKNVYKR 270
            |.:.::....|..| ||...||    ...|.|.|
  Fly   113 LNINDIAIVRLSTPLEFTSKVQPIPLAKTNPYPR 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15498NP_650974.1 None
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 21/99 (21%)
Tryp_SPc 27..243 CDD:238113 21/99 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.