DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15498 and LOC5667666

DIOPT Version :10

Sequence 1:NP_650974.1 Gene:CG15498 / 42548 FlyBaseID:FBgn0038892 Length:281 Species:Drosophila melanogaster
Sequence 2:XP_001689376.3 Gene:LOC5667666 / 5667666 VectorBaseID:AGAMI1_003505 Length:253 Species:Anopheles gambiae


Alignment Length:43 Identity:9/43 - (20%)
Similarity:14/43 - (32%) Gaps:18/43 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 VCRQQVSDQNLVLSVVITQEGLHRNCKTINEMCDLTVAPSPRP 116
            :|...|.|.:|.::..        :|.|          |.|.|
Mosquito    41 ICGASVVDASLAITAA--------HCLT----------PKPPP 65

Return to query results.
Submit another query.