DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15498 and PRSS3

DIOPT Version :9

Sequence 1:NP_650974.1 Gene:CG15498 / 42548 FlyBaseID:FBgn0038892 Length:281 Species:Drosophila melanogaster
Sequence 2:XP_011516267.1 Gene:PRSS3 / 5646 HGNCID:9486 Length:333 Species:Homo sapiens


Alignment Length:138 Identity:31/138 - (22%)
Similarity:45/138 - (32%) Gaps:28/138 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 EDDRTGQYLAYGEKFRLQALEPADEPMYVFSGPKRLNLSLPVEKAFFTTKNGEVTLPLGLVSHKN 193
            |..|...||....:..|....|.|:...:..|......|||.          :|:|..|  || .
Human    82 ERHRGSDYLPIRNQNELGVAVPFDDDDKIVGGYTCEENSLPY----------QVSLNSG--SH-F 133

  Fly   194 CGPSA-----RVPTSHTHFFCAHKDPDLRFES------EGKTIPVHNPLVIVHAVTNRNLAVENV 247
            ||.|.     .|..:|    |......:|...      ||....::...:|.|...||:....::
Human   134 CGGSLISEQWVVSAAH----CYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDI 194

  Fly   248 LANTLFGP 255
            :...|..|
Human   195 MLIKLSSP 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15498NP_650974.1 None
PRSS3XP_011516267.1 Tryp_SPc 109..325 CDD:214473 24/111 (22%)
Tryp_SPc 110..328 CDD:238113 24/110 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.