DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15498 and cfap161

DIOPT Version :9

Sequence 1:NP_650974.1 Gene:CG15498 / 42548 FlyBaseID:FBgn0038892 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001017774.1 Gene:cfap161 / 550471 ZFINID:ZDB-GENE-050417-296 Length:301 Species:Danio rerio


Alignment Length:304 Identity:78/304 - (25%)
Similarity:121/304 - (39%) Gaps:66/304 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 YGPGVKVGNWLETALSEEMRMSEMKKRRESGNLLLDRTRAVYDRFYQGTVLGPPQD-VLAFGVVV 65
            |.|.|:||||.|....||....|...:::.|.|.:.:..|:.....:...|...|| .|.||..|
Zfish     7 YNPRVRVGNWKEDVTLEEETSKEFILQKDRGELTVQKEGALKQSILKPVSLSVSQDGFLHFGDTV 71

  Fly    66 -----------QIRPVKIGVCRQQVSDQNLVLSVVITQEGLHRNCKTINEMCDLTV--APSPRPA 117
                       |..|..:.:    ::|.:.|.|...|..|.|.       :..|.|  |.|..|.
Zfish    72 MLVNCGDGGHMQRSPCVLSI----IADSSNVTSHSQTNTGPHL-------LGPLQVGGAHSMDPC 125

  Fly   118 LRNSFRIVSPNEDDRTGQYLAYGEKFRLQALEPADEPMYVFSGPKRLNLSLPVEKAFFTTKN--G 180
            :||:|.|:|. :....|:.:.|.:.|.|:                             ||..  |
Zfish   126 VRNTFIIISV-DGSSDGEVVRYDQSFALK-----------------------------TTGGFAG 160

  Fly   181 EVTLPLGLVSHKNCGPSARVP----TSHTHFFCAHK----DPDLRFESEGKTIPVHNPLVIVHAV 237
            |:.|.....|.:.|...:|:.    .....|.|..|    ||..|.|:||..:.|:|.::|.|..
Zfish   161 ELFLASDHKSFQKCAKKSRLQELSLVEEFDFLCWWKVLYFDPQDRLENEGYPVQVNNKVLISHCK 225

  Fly   238 TNRNL-AVENVLANTLFGPEFQVSVQTYKNVYKRETWKNLWKFT 280
            ||:.| |:.|.:..:.||.|::::..|:.:.:|.|...|.|.|:
Zfish   226 TNQCLAALSNHILWSQFGKEYELTAHTFLDSHKAEQDNNHWLFS 269



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595689
Domainoid 1 1.000 97 1.000 Domainoid score I7203
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12605
Inparanoid 1 1.050 97 1.000 Inparanoid score I5028
OMA 1 1.010 - - QHG56406
OrthoDB 1 1.010 - - D404512at33208
OrthoFinder 1 1.000 - - FOG0008126
OrthoInspector 1 1.000 - - otm26284
orthoMCL 1 0.900 - - OOG6_104967
Panther 1 1.100 - - LDO PTHR24274
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6078
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.910

Return to query results.
Submit another query.