DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15498 and CG10405

DIOPT Version :10

Sequence 1:NP_650974.1 Gene:CG15498 / 42548 FlyBaseID:FBgn0038892 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster


Alignment Length:98 Identity:22/98 - (22%)
Similarity:37/98 - (37%) Gaps:28/98 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 VFSGPKRLNLSLPVEKAFFTTKNGEVTLPLGLVSHKNCGPSARVPTSHTHFFCAHKDPDLRFESE 221
            ::..|......:..:.|...|.:|.::||||.|:      ..|:||                  .
  Fly   110 IYKHPAYDRADMNFDVALLRTADGALSLPLGKVA------PIRLPT------------------V 150

  Fly   222 GKTIPVHNPLVIV---HAVTNRNLAVENVLANT 251
            |:.|....|.|:.   |..|: |..:.:||.:|
  Fly   151 GEAISESMPAVVSGWGHMSTS-NPVLSSVLKST 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15498NP_650974.1 None
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 22/98 (22%)

Return to query results.
Submit another query.