DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15498 and CG10587

DIOPT Version :10

Sequence 1:NP_650974.1 Gene:CG15498 / 42548 FlyBaseID:FBgn0038892 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001137989.2 Gene:CG10587 / 40318 FlyBaseID:FBgn0037039 Length:289 Species:Drosophila melanogaster


Alignment Length:88 Identity:27/88 - (30%)
Similarity:33/88 - (37%) Gaps:37/88 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 TKNGE---------VTLPLGLVSHKNCGPSARVPT---SHTHF------------FCA---HKDP 214
            |:|.|         ||:|  :|..|.|..| .:||   ||.||            |||   .|..
  Fly   172 TENSEFGPQKLLRTVTVP--VVDKKKCRAS-YLPTDWESHKHFDLFLKVHLTDSMFCAGVLGKKD 233

  Fly   215 DLRFESEGKTIPVHNPLVIVHAV 237
            ...|:|.|       |||..:.|
  Fly   234 ACTFDSGG-------PLVYKNQV 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15498NP_650974.1 None
CG10587NP_001137989.2 Tryp_SPc 45..278 CDD:214473 27/88 (31%)

Return to query results.
Submit another query.