DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15498 and Send1

DIOPT Version :9

Sequence 1:NP_650974.1 Gene:CG15498 / 42548 FlyBaseID:FBgn0038892 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster


Alignment Length:138 Identity:31/138 - (22%)
Similarity:46/138 - (33%) Gaps:36/138 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 LTVAPSPRPALRNSFRIVSPNEDDRTG-------QYLAYGEKFRLQALEPADEPMYVFSGPKRLN 165
            |.::|.....|..|.||:..:..|.|.       ||  |||.               |.|....:
  Fly    14 LLISPVVPVLLEPSERIIGGSSMDITDVPWQVSLQY--YGEH---------------FCGGSIYS 61

  Fly   166 LSLPVEKAFFTTKNGEVTLPLGLVSHKNCGPSARVPT--SHTHFFCAHKDPD---------LRFE 219
            .::.:..| ...|.||.::..|...|.:.|....|..  .|..|...:.:.|         |.|.
  Fly    62 KTIIITAA-HCIKEGERSIRAGSSLHDSGGVVVGVEAYIIHPQFDKHNMENDVAVLKLSSPLSFS 125

  Fly   220 SEGKTIPV 227
            ...:|||:
  Fly   126 DSIQTIPL 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15498NP_650974.1 None
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 27/123 (22%)
Tryp_SPc 30..239 CDD:238113 26/122 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.