DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15498 and Ser6

DIOPT Version :9

Sequence 1:NP_650974.1 Gene:CG15498 / 42548 FlyBaseID:FBgn0038892 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster


Alignment Length:128 Identity:27/128 - (21%)
Similarity:49/128 - (38%) Gaps:29/128 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DRFYQGTVLGPPQDVLAFGVVVQIRPV----KIGVCRQQVS----DQNLVLSVVITQEGLHRNCK 100
            :||   |:.....|..:.||:||:..|    :.|.....|:    :..|:||..|....|    .
  Fly    89 ERF---TIRAGSNDRFSGGVLVQVAEVIVHEEYGNFLNDVALLRLESPLILSASIQPIDL----P 146

  Fly   101 TINEMCDLTVAPS-----------PRPALRNSFRIVSPNEDDRTGQYLAYGEKFRLQALEPAD 152
            |::...|:.|..|           ||....|:.:.::..:.:   :.:.:|.:..|..|...|
  Fly   147 TVDTPADVDVVISGWGRIKHQGDLPRYLQYNTLKSITRQQCE---ELIDFGFEGELCLLHQVD 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15498NP_650974.1 None
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 27/128 (21%)
Tryp_SPc 32..256 CDD:238113 27/128 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.