DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slou and HB18

DIOPT Version :10

Sequence 1:NP_001262808.1 Gene:slou / 42547 FlyBaseID:FBgn0002941 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_177248.3 Gene:HB18 / 843431 AraportID:AT1G70920 Length:206 Species:Arabidopsis thaliana


Alignment Length:49 Identity:15/49 - (30%)
Similarity:21/49 - (42%) Gaps:2/49 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly  1620 RKSKNKEVLIEGVLFRARYLGSTQLVCEGQPTKSTRMLQAEEAVSRIKV 1668
            |:.|.|:|...|..||..  ...:..|....|...:..:.:|||.|.||
plant    15 RRRKKKDVGEIGRRFRCG--EKKRQECANFRTFFYQGGKKKEAVFRAKV 61

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slouNP_001262808.1 Homeodomain 546..602 CDD:459649
HB18NP_177248.3 HOX 66..122 CDD:197696
HALZ 124..167 CDD:128634
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.