DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slou and AtHB23

DIOPT Version :10

Sequence 1:NP_001262808.1 Gene:slou / 42547 FlyBaseID:FBgn0002941 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_564268.1 Gene:AtHB23 / 839587 AraportID:AT1G26960 Length:255 Species:Arabidopsis thaliana


Alignment Length:73 Identity:30/73 - (41%)
Similarity:37/73 - (50%) Gaps:5/73 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   530 NGDGK-SGGGGGGGSKPRRARTAFTYEQLVSLENKFKTTRYLSVCERLNLALSLSLTETQVKIWF 593
            |||.: |..|...|.|.||    ...|||.:||..|:....|....:|.||.:|.|...|:.|||
plant    56 NGDEEYSDDGSKMGEKKRR----LNMEQLKALEKDFELGNKLESDRKLELARALGLQPRQIAIWF 116

  Fly   594 QNRRTKWK 601
            ||||.:.|
plant   117 QNRRARSK 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slouNP_001262808.1 Homeodomain 546..602 CDD:459649 23/56 (41%)
AtHB23NP_564268.1 HOX 71..124 CDD:197696 23/56 (41%)
HALZ 126..167 CDD:460477
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.