DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slou and HB5

DIOPT Version :10

Sequence 1:NP_001262808.1 Gene:slou / 42547 FlyBaseID:FBgn0002941 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_201334.1 Gene:HB5 / 836656 AraportID:AT5G65310 Length:312 Species:Arabidopsis thaliana


Alignment Length:97 Identity:31/97 - (31%)
Similarity:41/97 - (42%) Gaps:19/97 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   505 DDMCDDGSDIDDPSSETDSKKGGSRNGDGKSGGGGGGGSKPRRARTAFTYEQLVSLENKFKTTRY 569
            |.:.|||| ::|                  .||.|...|.....:.....||:.:||..|:....
plant    48 DALEDDGS-LED------------------LGGVGHASSTAAEKKRRLGVEQVKALEKNFEIDNK 93

  Fly   570 LSVCERLNLALSLSLTETQVKIWFQNRRTKWK 601
            |....::.||..|.|...||.|||||||.:||
plant    94 LEPERKVKLAQELGLQPRQVAIWFQNRRARWK 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slouNP_001262808.1 Homeodomain 546..602 CDD:459649 21/56 (38%)
HB5NP_201334.1 Homeodomain 72..125 CDD:459649 19/52 (37%)
HALZ 127..168 CDD:460477
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.