DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slou and HB16

DIOPT Version :10

Sequence 1:NP_001262808.1 Gene:slou / 42547 FlyBaseID:FBgn0002941 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_195716.1 Gene:HB16 / 830169 AraportID:AT4G40060 Length:294 Species:Arabidopsis thaliana


Alignment Length:113 Identity:32/113 - (28%)
Similarity:44/113 - (38%) Gaps:24/113 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   505 DDMCDDGSDIDDPSSETDSKKGGSRNGDGKSGG------------GG----GGGSKPRRARTAFT 553
            |.||    .:...|::..|.:|...|......|            |.    |...|.||.:.   
plant     8 DSMC----GLISTSTDEQSPRGYGSNYQSMLEGYDEDATLIEEYSGNHHHMGLSEKKRRLKV--- 65

  Fly   554 YEQLVSLENKFKTTRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWK 601
             :|:.:||..|:....|....:..||..|.|...||.:||||||.:||
plant    66 -DQVKALEKNFELENKLEPERKTKLAQELGLQPRQVAVWFQNRRARWK 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slouNP_001262808.1 Homeodomain 546..602 CDD:459649 21/56 (38%)
HB16NP_195716.1 Homeodomain 59..112 CDD:459649 20/56 (36%)
HALZ 114..155 CDD:460477
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.