DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slou and HB-12

DIOPT Version :10

Sequence 1:NP_001262808.1 Gene:slou / 42547 FlyBaseID:FBgn0002941 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_191748.1 Gene:HB-12 / 825362 AraportID:AT3G61890 Length:235 Species:Arabidopsis thaliana


Alignment Length:60 Identity:22/60 - (36%)
Similarity:35/60 - (58%) Gaps:0/60 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   552 FTYEQLVSLENKFKTTRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQNPGMDVNS 611
            |:.||:.|||..|::...|...:::.:|..|.|...||.|||||:|.:||.:....:.|:
plant    34 FSEEQIKSLELIFESETRLEPRKKVQVARELGLQPRQVAIWFQNKRARWKTKQLEKEYNT 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slouNP_001262808.1 Homeodomain 546..602 CDD:459649 20/49 (41%)
HB-12NP_191748.1 Homeodomain 33..83 CDD:459649 19/48 (40%)
HALZ 85..126 CDD:460477 1/9 (11%)

Return to query results.
Submit another query.