DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slou and HB-7

DIOPT Version :10

Sequence 1:NP_001262808.1 Gene:slou / 42547 FlyBaseID:FBgn0002941 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_182191.1 Gene:HB-7 / 819280 AraportID:AT2G46680 Length:258 Species:Arabidopsis thaliana


Alignment Length:59 Identity:23/59 - (38%)
Similarity:34/59 - (57%) Gaps:0/59 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   552 FTYEQLVSLENKFKTTRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQNPGMDVN 610
            |:.||:.|||..|::...|...:::.||..|.|...||.|||||:|.:||.:....:.|
plant    36 FSDEQIKSLEMMFESETRLEPRKKVQLARELGLQPRQVAIWFQNKRARWKSKQLETEYN 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slouNP_001262808.1 Homeodomain 546..602 CDD:459649 21/49 (43%)
HB-7NP_182191.1 Homeodomain 35..85 CDD:459649 20/48 (42%)
HALZ 87..126 CDD:460477 1/8 (13%)

Return to query results.
Submit another query.