DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slou and HB6

DIOPT Version :10

Sequence 1:NP_001262808.1 Gene:slou / 42547 FlyBaseID:FBgn0002941 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_565536.1 Gene:HB6 / 816775 AraportID:AT2G22430 Length:311 Species:Arabidopsis thaliana


Alignment Length:101 Identity:29/101 - (28%)
Similarity:42/101 - (41%) Gaps:20/101 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   517 PSSETDS---KKGGSRNGDG-------------KSGGGGGGGSKPRRARTAFTYEQLVSLENKFK 565
            |::.||.   ::.|.|....             :..|..|...|.||    .:..|:.:||..|:
plant    19 PTTSTDEQSPRRYGGREFQSMLEGYEEEEEAIVEERGHVGLSEKKRR----LSINQVKALEKNFE 79

  Fly   566 TTRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWK 601
            ....|....::.||..|.|...||.:||||||.:||
plant    80 LENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWK 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slouNP_001262808.1 Homeodomain 546..602 CDD:459649 21/56 (38%)
HB6NP_565536.1 Homeodomain 62..115 CDD:459649 20/56 (36%)
HALZ 117..158 CDD:460477
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.