DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slou and Nkx6-3

DIOPT Version :10

Sequence 1:NP_001262808.1 Gene:slou / 42547 FlyBaseID:FBgn0002941 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_083278.1 Gene:Nkx6-3 / 74561 MGIID:1921811 Length:262 Species:Mus musculus


Alignment Length:110 Identity:44/110 - (40%)
Similarity:61/110 - (55%) Gaps:21/110 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   512 SDIDDPSSETDSKKGGSRNGDGKSGGGGGGGSKPRRARTAFTYEQLVSLENKFKTTRYLSVCERL 576
            |:..||.|:|..||                    :..|..||..|:.:||..|:.|:||:..||.
Mouse   127 SNTPDPLSDTIHKK--------------------KHTRPTFTGHQIFALEKTFEQTKYLAGPERA 171

  Fly   577 NLALSLSLTETQVKIWFQNRRTKWKKQNPGMDVNSPTIPPPGGGS 621
            .||.||.:||:|||:|||||||||:|:: .::.:|.|...|||.|
Mouse   172 RLAYSLGMTESQVKVWFQNRRTKWRKKS-ALEPSSSTPRAPGGAS 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slouNP_001262808.1 Homeodomain 546..602 CDD:459649 30/55 (55%)
Nkx6-3NP_083278.1 Homeodomain 139..197 CDD:459649 32/77 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..237 7/20 (35%)

Return to query results.
Submit another query.