DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slou and Nanog

DIOPT Version :10

Sequence 1:NP_001262808.1 Gene:slou / 42547 FlyBaseID:FBgn0002941 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_082292.1 Gene:Nanog / 71950 MGIID:1919200 Length:305 Species:Mus musculus


Alignment Length:243 Identity:59/243 - (24%)
Similarity:90/243 - (37%) Gaps:67/243 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   403 GSHSTPSVCPVDLTRSVNSSAAANPSSASTSASSDRDAATKRLAFSVENILDPNKFTGNKLPSGP 467
            |.||.||           |..|:|..:||:.                     |..|         
Mouse     7 GPHSLPS-----------SEEASNSGNASSM---------------------PAVF--------- 30

  Fly   468 FGHPRQWSYERDEEMQERLDDDQSEDMSAQDLNDMDQDDMCDDGSDIDDPSSETDSKKGGSRNGD 532
              ||..:|..:....:....:..|...|::||......|           ||.:..:|..|...|
Mouse    31 --HPENYSCLQGSATEMLCTEAASPRPSSEDLPLQGSPD-----------SSTSPKQKLSSPEAD 82

  Fly   533 -GKSGGGGGGGSKPRRARTAFTYEQLVSLENKFKTTRYLSVCERLNLALSLSLTETQVKIWFQNR 596
             |.........::.::.||.|:..||.:|:::|:..:|||:.:...|:..|:|:..|||.||||:
Mouse    83 KGPEEEENKVLARKQKMRTVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQ 147

  Fly   597 RTK--------WKKQNPGM-DVNSPTIPPPGGGSFGPGAY---ASGLL 632
            |.|        |.|.:.|: ...|..:..|......|..|   |||.|
Mouse   148 RMKCKRWQKNQWLKTSNGLIQKGSAPVEYPSIHCSYPQGYLVNASGSL 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slouNP_001262808.1 Homeodomain 546..602 CDD:459649 23/63 (37%)
NanogNP_082292.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30 11/54 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 46..95 11/59 (19%)
Sufficient for interaction with SALL4. /evidence=ECO:0000269|PubMed:16840789 96..155 22/58 (38%)
Homeodomain 98..153 CDD:459649 22/54 (41%)
Required for DNA-binding. /evidence=ECO:0000250|UniProtKB:Q9H9S0 123..152 12/28 (43%)
PTZ00395 <190..>250 CDD:185594 4/6 (67%)
10 X repeats starting with a Trp in each unit 198..247
Sufficient for transactivation activity 198..247
Sufficient for strong transactivation activity 248..305
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.