DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slou and Barx2

DIOPT Version :9

Sequence 1:NP_001262808.1 Gene:slou / 42547 FlyBaseID:FBgn0002941 Length:698 Species:Drosophila melanogaster
Sequence 2:XP_003750505.1 Gene:Barx2 / 679701 RGDID:1584840 Length:290 Species:Rattus norvegicus


Alignment Length:208 Identity:57/208 - (27%)
Similarity:82/208 - (39%) Gaps:84/208 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   408 PSVCPVDLTRSVNSSAAANPSSASTSASSDRDAATKRLAFSVENILDPNKFTGNKLPSGPFGHPR 472
            |.:.||:...:|.:.|||..::|:.:|:::                         .|.|      
  Rat    91 PGLTPVNTRHAVAAEAAAAAAAAAAAAAAE-------------------------TPGG------ 124

  Fly   473 QWSYERDEEMQERLDDDQSEDMSAQDLNDMDQDDMCDDGSDIDDPSSETDSKKGGSRNGDGKSGG 537
                       |.|                              .|||:::::...|.       
  Rat   125 -----------EAL------------------------------ASSESETEQPTPRQ------- 141

  Fly   538 GGGGGSKPRRARTAFTYEQLVSLENKFKTTRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKK 602
                 .||||:||.||..||:.||.||:..:|||..:||:||.||.||:.|||.|:||||.||||
  Rat   142 -----KKPRRSRTIFTELQLMGLEKKFQKQKYLSTPDRLDLAQSLGLTQLQVKTWYQNRRMKWKK 201

  Fly   603 QNPGMDVNSPTIP 615
            ........:||.|
  Rat   202 MVLKGGQEAPTKP 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slouNP_001262808.1 Homeobox 549..601 CDD:278475 30/51 (59%)
Barx2XP_003750505.1 Homeobox 147..200 CDD:278475 30/52 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.