DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slou and vox

DIOPT Version :9

Sequence 1:NP_001262808.1 Gene:slou / 42547 FlyBaseID:FBgn0002941 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_571773.1 Gene:vox / 64807 ZFINID:ZDB-GENE-010108-1 Length:242 Species:Danio rerio


Alignment Length:237 Identity:63/237 - (26%)
Similarity:94/237 - (39%) Gaps:51/237 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   449 VENILDPNKFTGNKL-----PSGPFGHPRQWSYERDEEMQERLDDDQSEDMSAQ------DLNDM 502
            |..:.:|.|.|...:     |..|..:.:.:...:.:..:..|..:.|::..||      .....
Zfish    19 VLEVQEPEKKTRPHVPCVVQPRPPTSYDKVYLQPKPKINKAELKTESSKETPAQVTPRNCSSPSF 83

  Fly   503 DQDDMCDDGSDIDDPSSETDSKKGGSRNGDGKSGGGGGGGSKPRRARTAFTYEQLVSLENKFKTT 567
            .::.....|.:.:..:||..|.:.|.   |.:..|.      .||.||.||.||:..||..|...
Zfish    84 SENSGYSSGYESEAAASECASVEDGH---DAEKDGA------TRRIRTKFTPEQIDKLEKIFNKH 139

  Fly   568 RYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQNPGMD--------VNSPTIPPPGGGSFGP 624
            :||...||:..||.|.|:|||::.||||||.|.|::...|.        |..|.||         
Zfish   140 KYLDAGERVKTALKLGLSETQIRTWFQNRRMKLKREVQEMRADFLLPQMVLPPVIP--------- 195

  Fly   625 GAYASGLLYS----HAVPYPPYGPYFH----PLGAHHLSHSH 658
                  :.|.    ..:|:||:||...    ||..||....|
Zfish   196 ------VQYQCYDRQRLPFPPHGPLVQQMMMPLHPHHPHPQH 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slouNP_001262808.1 Homeobox 549..601 CDD:278475 27/51 (53%)
voxNP_571773.1 COG5576 75..>187 CDD:227863 38/120 (32%)
Homeobox 121..173 CDD:278475 27/51 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.