DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slou and BARHL1

DIOPT Version :9

Sequence 1:NP_001262808.1 Gene:slou / 42547 FlyBaseID:FBgn0002941 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_064448.1 Gene:BARHL1 / 56751 HGNCID:953 Length:327 Species:Homo sapiens


Alignment Length:341 Identity:92/341 - (26%)
Similarity:132/341 - (38%) Gaps:92/341 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   331 VSNASISISNSSSGSPSGRDLSDYGFRIQLGGLAAAAAAAAATSRQIAAATYARSDTSEELNVDG 395
            :|..|.|.|:.||.:..|||..:.| ..:.||.:.....:.....|::|...:|:.||       
Human    38 LSPRSESSSDCSSPASPGRDCLETG-TPRPGGASGPGLDSHLQPGQLSAPAQSRTVTS------- 94

  Fly   396 NDEDSNDGSHSTPSVCPVDLTRSVNSSAAANPSSASTSASSDRDAATKRLAFSVENILDPNKFTG 460
                         |....|:.......||..|.|     ||.:.||.:                 
Human    95 -------------SFLIRDILADCKPLAACAPYS-----SSGQPAAPE----------------- 124

  Fly   461 NKLPSGPFGHPRQWSYERDEEMQERLDDDQSEDMSAQDLNDMDQDDMCDDGSDIDDPSSETDSKK 525
               |.|      :.:.:..|:.:::||...|...|..:....::.|. :..|..|.|....    
Human   125 ---PGG------RLAAKAAEDFRDKLDKSGSNASSDSEYKVKEEGDR-EISSSRDSPPVRL---- 175

  Fly   526 GGSRNGDGKSGGGGGGGSKPRRARTAFTYEQLVSLENKFKTTRYLSVCERLNLALSLSLTETQVK 590
                             .|||:||||||..||..||..|:..:||||.:|:.||.||:||:||||
Human   176 -----------------KKPRKARTAFTDHQLAQLERSFERQKYLSVQDRMELAASLNLTDTQVK 223

  Fly   591 IWFQNRRTKWKKQNP-GMDVNSPT---------IPPPGGGSFGPGAYASGL-----LYSHAVPYP 640
            .|:||||||||:|.. |:::.:..         .|.|   .|.|.:..|.|     ||.:..|..
Human   224 TWYQNRRTKWKRQTAVGLELLAEAGNYSALQRMFPSP---YFYPQSLVSNLDPGAALYLYRGPSA 285

  Fly   641 PYGPYFHPLGAHHLSH 656
            |......||....|.|
Human   286 PPPALQRPLVPRILIH 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slouNP_001262808.1 Homeobox 549..601 CDD:278475 32/51 (63%)
BARHL1NP_064448.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..90 14/52 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 112..184 22/124 (18%)
Homeobox 182..235 CDD:395001 33/52 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..327
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.