DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slou and lbx1a

DIOPT Version :9

Sequence 1:NP_001262808.1 Gene:slou / 42547 FlyBaseID:FBgn0002941 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_001020703.1 Gene:lbx1a / 564103 ZFINID:ZDB-GENE-040724-40 Length:269 Species:Danio rerio


Alignment Length:316 Identity:75/316 - (23%)
Similarity:105/316 - (33%) Gaps:114/316 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   398 EDSNDGSHSTPSVCPVD-LTRSVNSSAAANPSSASTSASSDRDAATKRLAFSVENILDPNK---- 457
            ||:...|.......|:| |....||:....|                   ||:|:||  ||    
Zfish     5 EDAKGASVEDRRRSPLDHLPPPANSNKPLTP-------------------FSIEDIL--NKPSVK 48

  Fly   458 ------------FTGNKLPSGPFGHPRQWSYERDEEMQERLDDDQSEDMSAQDLNDMDQDDMCDD 510
                        .:|.|.||  .|||          :..|....|:..:.|              
Zfish    49 RSYTICGTAHLLSSGEKHPS--TGHP----------LSNRALLTQTSPLCA-------------- 87

  Fly   511 GSDIDDPSSETDSKKGGS----RNGDGKSG----GGGGGGSKPRRARTAFTYEQLVSLENKFKTT 567
               :::.:|:|  .||..    :..:|:.|    |......|.|::|||||..|:..||.:|...
Zfish    88 ---LEELASKT--FKGLEVSVLQAAEGRDGMTLFGQRNTPKKRRKSRTAFTNHQIYELEKRFLYQ 147

  Fly   568 RYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQNPGMDVNSPTIPPPG-------------- 618
            :|||..:|..:|..|.||..||..||||||.|.|:....|..:..:....|              
Zfish   148 KYLSPADRDQIAQQLGLTNAQVITWFQNRRAKLKRDLEEMKADVESAKAVGNVPFEKMAKLADLE 212

  Fly   619 ---GGSFGPGAYAS---------GLLYSHAVPYPPYGPYFHPLGAHHLSHSHSXNC 662
               .|:.|..:..|         |....|..|..||           ..|:.|..|
Zfish   213 KRVNGTLGDSSAVSPSRSNHEHEGTNKLHMSPSSPY-----------TDHTTSKEC 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slouNP_001262808.1 Homeobox 549..601 CDD:278475 26/51 (51%)
lbx1aNP_001020703.1 Homeobox 128..181 CDD:278475 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.