DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slou and Noto

DIOPT Version :10

Sequence 1:NP_001262808.1 Gene:slou / 42547 FlyBaseID:FBgn0002941 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_001178943.1 Gene:Noto / 502857 RGDID:1562910 Length:245 Species:Rattus norvegicus


Alignment Length:83 Identity:37/83 - (44%)
Similarity:44/83 - (53%) Gaps:10/83 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   546 RRARTAFTYEQLVSLENKFKTTRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQNPGMDVN 610
            :|.||.|:.:||..||..|.....|...||..||..|.|||.||:|||||||.|::||   ..:.
  Rat   155 KRVRTMFSEQQLGELEKVFAKQHNLVGKERAQLAARLHLTENQVRIWFQNRRVKYQKQ---QKLK 216

  Fly   611 SPTIPP-----PGGGSFG 623
            ||  ||     |...|.|
  Rat   217 SP--PPDAMEEPSNSSEG 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slouNP_001262808.1 Homeodomain 546..602 CDD:459649 28/55 (51%)
NotoNP_001178943.1 Homeodomain 155..211 CDD:459649 28/55 (51%)

Return to query results.
Submit another query.