DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slou and Hoxb5

DIOPT Version :9

Sequence 1:NP_001262808.1 Gene:slou / 42547 FlyBaseID:FBgn0002941 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_001178854.1 Gene:Hoxb5 / 497987 RGDID:1562292 Length:269 Species:Rattus norvegicus


Alignment Length:311 Identity:86/311 - (27%)
Similarity:124/311 - (39%) Gaps:74/311 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 NSSSGS-PSGRD--LSDYGFRIQLGGLAAAAAAAAATSRQIAAATYARSDTSEELNVDGNDEDSN 401
            ||.||. |:|.|  |.:||....|.|.....||       :...:|..:....:|:|:.:...|:
  Rat     7 NSFSGRYPNGPDYQLLNYGSGSSLSGSYRDPAA-------MHTGSYGYNYNGMDLSVNRSSASSS 64

  Fly   402 ------DGSHSTPSVCPVDLTRSVNSSAA-ANPSS----------ASTSASSDRDAATKRLAFSV 449
                  :.|.:.|:.......|...||.: ::|.|          |..||||..|.||.  |.|.
  Rat    65 HFGAVGESSRAFPASAQEPRFRQATSSCSLSSPESLPCTNGDSHGAKPSASSPSDQATP--ASSS 127

  Fly   450 ENILDPNKFTGNKLPSGPFGHPRQWSYERDEEMQERLDDDQSEDMSAQDLNDMDQDDMCDDGSDI 514
            .|      ||                 |.||.......::.:..:|:..|.....:.|   .:..
  Rat   128 AN------FT-----------------EIDEASASSEPEEAASQLSSPSLARAQPEPM---ATST 166

  Fly   515 DDPSSETDS------KKGGSRNGDGKSGGGGGGGSKPRRARTAFTYEQLVSLENKFKTTRYLSVC 573
            ..|..:|..      |...|.:..|..|         :|||||:|..|.:.||.:|...|||:..
  Rat   167 AAPEGQTPQIFPWMRKLHISHDMTGPDG---------KRARTAYTRYQTLELEKEFHFNRYLTRR 222

  Fly   574 ERLNLALSLSLTETQVKIWFQNRRTKWKKQNPGMDVNSPTIPPPGGGSFGP 624
            .|:.:|.:|.|:|.|:||||||||.||||.|....::..|    .|.:|.|
  Rat   223 RRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSLAT----AGSAFQP 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slouNP_001262808.1 Homeobox 549..601 CDD:278475 26/51 (51%)
Hoxb5NP_001178854.1 PRK07003 <67..>171 CDD:235906 27/131 (21%)
Homeobox 198..251 CDD:365835 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.