DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slou and Hoxb7

DIOPT Version :10

Sequence 1:NP_001262808.1 Gene:slou / 42547 FlyBaseID:FBgn0002941 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_001017480.1 Gene:Hoxb7 / 497985 RGDID:1559918 Length:219 Species:Rattus norvegicus


Alignment Length:69 Identity:33/69 - (47%)
Similarity:45/69 - (65%) Gaps:4/69 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   542 GSKPRRARTAFTYEQLVSLENKFKTTRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQN-- 604
            |::.:|.|..:|..|.:.||.:|...|||:...|:.:|.:|.|||.|:||||||||.||||:|  
  Rat   134 GTERKRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKT 198

  Fly   605 --PG 606
              ||
  Rat   199 SGPG 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slouNP_001262808.1 Homeodomain 546..602 CDD:459649 27/55 (49%)
Hoxb7NP_001017480.1 Antp-type hexapeptide 126..131
Homeodomain 138..194 CDD:459649 27/55 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 193..219 5/10 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.