DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slou and emx1

DIOPT Version :10

Sequence 1:NP_001262808.1 Gene:slou / 42547 FlyBaseID:FBgn0002941 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_001005459.1 Gene:emx1 / 448058 XenbaseID:XB-GENE-920144 Length:233 Species:Xenopus tropicalis


Alignment Length:60 Identity:36/60 - (60%)
Similarity:45/60 - (75%) Gaps:0/60 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   544 KPRRARTAFTYEQLVSLENKFKTTRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQ 603
            ||:|.||||:..||:.||..|:...|:...||..||.||||:|||||:||||||||:|:|
 Frog   134 KPKRIRTAFSPSQLLRLERAFEKNHYVVGAERKQLASSLSLSETQVKVWFQNRRTKYKRQ 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slouNP_001262808.1 Homeodomain 546..602 CDD:459649 32/55 (58%)
emx1NP_001005459.1 Homeodomain 136..192 CDD:459649 32/55 (58%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 192..233 1/2 (50%)

Return to query results.
Submit another query.