DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slou and DBX2

DIOPT Version :9

Sequence 1:NP_001262808.1 Gene:slou / 42547 FlyBaseID:FBgn0002941 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_001004329.2 Gene:DBX2 / 440097 HGNCID:33186 Length:339 Species:Homo sapiens


Alignment Length:151 Identity:46/151 - (30%)
Similarity:67/151 - (44%) Gaps:19/151 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   543 SKPRRA---RTAFTYEQLVSLENKFKTTRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQN 604
            ||.||.   |..|:.:|..:||..|:..:|:|..:|..||::|.|.|:||||||||||.||:...
Human   181 SKARRGILRRAVFSEDQRKALEKMFQKQKYISKTDRKKLAINLGLKESQVKIWFQNRRMKWRNSK 245

  Fly   605 PGMDVNSPTIPPPGGGSFGPGAYASGLLYSHAVPYPPYGPYFHPLGAHHLSHSHSXNC-KMQQRL 668
            ....:::..|...|        .....|...|:.:|...|....:...|.|.....|. :..:||
Human   246 EKEVLSNRCIQEVG--------LQEDPLSRSALGFPSPCPSIWDVPQQHSSPRWRENSPEPSERL 302

  Fly   669 LQLFEKRGRAVAGGAGPAAGS 689
            :|       ..:|...|.|.|
Human   303 IQ-------ESSGAPPPEANS 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slouNP_001262808.1 Homeobox 549..601 CDD:278475 25/51 (49%)
DBX2NP_001004329.2 Homeobox 189..242 CDD:278475 25/52 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 282..318 10/42 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.