DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slou and ro

DIOPT Version :9

Sequence 1:NP_001262808.1 Gene:slou / 42547 FlyBaseID:FBgn0002941 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_524521.1 Gene:ro / 43234 FlyBaseID:FBgn0003267 Length:350 Species:Drosophila melanogaster


Alignment Length:153 Identity:50/153 - (32%)
Similarity:69/153 - (45%) Gaps:21/153 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   544 KPRRARTAFTYEQLVSLENKFKTTRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKK------ 602
            :.||.||.|:.||.:.||.:|....|:|...|..||.:|.|||||:||||||||.|.|:      
  Fly   190 RQRRQRTTFSTEQTLRLEVEFHRNEYISRSRRFELAETLRLTETQIKIWFQNRRAKDKRIEKAQI 254

  Fly   603 -------------QNPGMDVNSPTIPPPGGGSFGPGAYASGLLYSHAVPYPPYGPYFHPLGAHHL 654
                         .:..|...:.|:||  ||..|..|...||.|..|...|...|..:...|:.:
  Fly   255 DQHYRNFVVANGFMSSIMGQAATTMPP--GGVTGGVAVGVGLNYYAAAATPAALPKDNTQDANFI 317

  Fly   655 SHSHSXNCKMQQRLLQLFEKRGR 677
            ........:.||:..|..:::.|
  Fly   318 DIDDQFQRQQQQKQQQQQQQQRR 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slouNP_001262808.1 Homeobox 549..601 CDD:278475 28/51 (55%)
roNP_524521.1 Homeobox 196..247 CDD:278475 27/50 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.