DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slou and C15

DIOPT Version :9

Sequence 1:NP_001262808.1 Gene:slou / 42547 FlyBaseID:FBgn0002941 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_476873.2 Gene:C15 / 42544 FlyBaseID:FBgn0004863 Length:339 Species:Drosophila melanogaster


Alignment Length:293 Identity:69/293 - (23%)
Similarity:106/293 - (36%) Gaps:117/293 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   389 EELNVD-----------GNDEDSNDGSHSTPSVCPV------DLTRSVNSS-------------- 422
            :|::||           |:|.|.:.||....|..|:      :.|||.:|.              
  Fly    22 QEIHVDVDSDSRMSCGSGSDVDMDGGSCYDESETPLSESLQSEQTRSSSSENLPFSISRLLSKPF 86

  Fly   423 -------------AAANPSSASTSASS-------------DRDAATKRLAFSVENI--------- 452
                         .:::|.|:|.:.:|             |.|.|.| ||.|:.|.         
  Fly    87 ETSHHHHNNNNHLLSSSPGSSSNNNNSGEKGEEKELLQQEDHDLAYK-LATSIANSTYGSAAALY 150

  Fly   453 ----LDPNKFTGNKLPSGPFGHPRQWSYE-------RDEEMQERLDDDQSEDMSAQDLNDMDQDD 506
                |.|:...|:.|...|...|..|:..       ..:.:::||       .:|..:       
  Fly   151 SYPHLYPSAAGGHVLRVPPQRTPLTWALPPLHHAALAHQAVKDRL-------AAAFPI------- 201

  Fly   507 MCDDGSDIDDP-SSETDSKKGGSRNGDGKSGGGGGGGSKPRRARTAFTYEQLVSLENKFKTTRYL 570
                ...|..| .:.|..|:                    ::.||:||..|:..||.:|...:||
  Fly   202 ----ARRIGHPYQNRTPPKR--------------------KKPRTSFTRIQVAELEKRFHKQKYL 242

  Fly   571 SVCERLNLALSLSLTETQVKIWFQNRRTKWKKQ 603
            :..||..||..|.:|:.|||.|||||||||::|
  Fly   243 ASAERAALARGLKMTDAQVKTWFQNRRTKWRRQ 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slouNP_001262808.1 Homeobox 549..601 CDD:278475 27/51 (53%)
C15NP_476873.2 COG5576 <196..315 CDD:227863 34/111 (31%)
Homeobox 220..273 CDD:278475 27/52 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E1_KOG0488
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.