DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slou and lbe

DIOPT Version :9

Sequence 1:NP_001262808.1 Gene:slou / 42547 FlyBaseID:FBgn0002941 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_524435.2 Gene:lbe / 42542 FlyBaseID:FBgn0011278 Length:479 Species:Drosophila melanogaster


Alignment Length:475 Identity:113/475 - (23%)
Similarity:155/475 - (32%) Gaps:174/475 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 PAHPHSHQHPHPHPHPHPHPHPSAV---------------------------------------F 238
            |.....|.|||.||||..||..|.:                                       |
  Fly    25 PLPTQHHTHPHSHPHPLQHPRASTIDLLQQQQLLMQHHAAAAAAAAAAASGLTRSAVGNLPEDYF 89

  Fly   239 H----LRAPSSSS------TAPPSPATSPLSPPTSPAM--------------HSDQQMSPPIAPP 279
            |    ||..||||      .:|||....|.:..|:.:.              ||::|....::||
  Fly    90 HPLKRLRMSSSSSEPRDHTPSPPSAVPEPQTNQTTKSAIEGVKSFSIADILGHSEKQREESVSPP 154

  Fly   280 QN----PPHSSQPPQQQQVAAPSDMDLERIKLVAAVAARTTQASSTSALASASNSVSNASISISN 340
            .|    .|.:|:|      .|||.         ..:..||.......|.|:|....|...:...:
  Fly   155 PNANLLAPPASRP------IAPSG---------GLLQPRTEPLDVHPAAAAAMLLPSGQIVRPWD 204

  Fly   341 SSSGS--------PSGRDLSDYGFRIQLGGLAAAAAAAAATSRQIAAATYARSDTSEELNVDGND 397
            ...|.        ||.  |..|..|:.|.           ..||:.....|::.....:.::...
  Fly   205 HLLGPTMPVRPFIPSA--LLHYEQRLALD-----------YHRQLQEHFNAQAQLLRHMGMNPAI 256

  Fly   398 EDSNDGSHSTPSVCPVDLTRSVNSSAAANPSSASTSASSDRDAATKRLAFSVENILDPNKFTGNK 462
            ..|.|||..          ||..||:    |:.||...|.|.|         |.:   .|.|   
  Fly   257 IASEDGSSE----------RSQRSSS----SNGSTECCSPRQA---------EKL---EKLT--- 292

  Fly   463 LPSGPFGHPRQWSYERDEEMQERLDDDQSEDMSAQDLNDMDQD----------DMCDDGSDIDDP 517
                        :.|..||.|::..::|... |.:...|...|          |...|.|.:|..
  Fly   293 ------------TQEGSEEAQKKKSEEQPTG-SGKSNGDTPLDALFQMTTKDFDESQDKSHLDIF 344

  Fly   518 SSETDSKKGGSRNGDGKSGGGGGGGSKPRRARTAFTYEQLVSLENKFKTTRYLSVCERLNLALSL 582
            |:....|                   |.|::|||||..|:..||.:|...:|||..:|..:|.||
  Fly   345 SNRPQPK-------------------KKRKSRTAFTNHQIFELEKRFLYQKYLSPADRDEIAASL 390

  Fly   583 SLTETQVKIWFQNRRTKWKK 602
            .|:..||..||||||.|.|:
  Fly   391 GLSNAQVITWFQNRRAKQKR 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slouNP_001262808.1 Homeobox 549..601 CDD:278475 26/51 (51%)
lbeNP_524435.2 Homeobox 356..410 CDD:395001 26/53 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E1_KOG0488
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.