DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slou and bap

DIOPT Version :9

Sequence 1:NP_001262808.1 Gene:slou / 42547 FlyBaseID:FBgn0002941 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_732637.1 Gene:bap / 42537 FlyBaseID:FBgn0004862 Length:382 Species:Drosophila melanogaster


Alignment Length:357 Identity:92/357 - (25%)
Similarity:127/357 - (35%) Gaps:127/357 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   364 AAAAAAAAATSRQIAA-------ATYARSDTSEELNVDGNDE-----DSNDGSHS---TPSVCPV 413
            |..:||.|..|:.:..       .|.:..:|....:||...|     .|:|...|   :|.:|..
  Fly     7 AGVSAAMAGLSKSLTTPFSINDILTRSNPETRRMSSVDSEPEPEKLKPSSDRERSISKSPPLCCR 71

  Fly   414 DL-------TRSVNSSAAANPS------------------SASTSASSDRDAATKRLAFSVENIL 453
            ||       .:.:..| |..||                  :..||.||..|...::||:....:.
  Fly    72 DLGLYKLTQPKEIQPS-ARQPSNYLQYYAAAMDNNNHHHQATGTSNSSAADYMQRKLAYFGSTLA 135

  Fly   454 DPNKFTGNKLPSGPFGHPRQWSYERDEEMQERLDDDQSEDMSAQDLNDMDQDDMCDDGSDIDDPS 518
            .|                                    .||.....||.|    ||....:....
  Fly   136 AP------------------------------------LDMRRCTSNDSD----CDSPPPLSSSP 160

  Fly   519 SETDSKKGGSRNGDGKSGGGGGGGSKPRRARTAFTYEQLVSLENKFKTTRYLSVCERLNLALSLS 583
            ||:.....||            |.|:.:|:|.||::.|:..||.:|...||||..||..:|.||.
  Fly   161 SESPLSHDGS------------GLSRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLR 213

  Fly   584 LTETQVKIWFQNRRTKWKKQN--------PGMDVNSPT---IPPPGGGSF----GPGAYASGL-- 631
            ||||||||||||||.|.|::.        .|.....|.   :...|..::    .||| ..||  
  Fly   214 LTETQVKIWFQNRRYKTKRKQIQQHEAALLGASKRVPVQVLVREDGSTTYAHMAAPGA-GHGLDP 277

  Fly   632 ----LYSH-------AVPYP----PYGPYFHP 648
                :|.|       .:|.|    |: |||:|
  Fly   278 ALINIYRHQLQLAYGGLPLPQMQMPF-PYFYP 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slouNP_001262808.1 Homeobox 549..601 CDD:278475 31/51 (61%)
bapNP_732637.1 Homeobox 178..231 CDD:278475 31/52 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442245
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24340
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.