DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slou and cdx1a

DIOPT Version :10

Sequence 1:NP_001262808.1 Gene:slou / 42547 FlyBaseID:FBgn0002941 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_998001.2 Gene:cdx1a / 405762 ZFINID:ZDB-GENE-050510-1 Length:228 Species:Danio rerio


Alignment Length:66 Identity:27/66 - (40%)
Similarity:44/66 - (66%) Gaps:1/66 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   540 GGGSKPR-RARTAFTYEQLVSLENKFKTTRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQ 603
            ||.::.: :.|..::..|.:.||.:|..:||:::..:..||.:|:|:|.||||||||||.|.:|.
Zfish   123 GGKTRTKDKYRVVYSDVQRLELEKEFHFSRYITIRRKAELAGTLNLSERQVKIWFQNRRAKERKM 187

  Fly   604 N 604
            |
Zfish   188 N 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slouNP_001262808.1 Homeodomain 546..602 CDD:459649 23/56 (41%)
cdx1aNP_998001.2 Caudal_act 11..123 CDD:461413 27/66 (41%)
Homeodomain 131..186 CDD:459649 23/54 (43%)

Return to query results.
Submit another query.