DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slou and ventx2.1

DIOPT Version :9

Sequence 1:NP_001262808.1 Gene:slou / 42547 FlyBaseID:FBgn0002941 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_988862.1 Gene:ventx2.1 / 394456 XenbaseID:XB-GENE-919664 Length:333 Species:Xenopus tropicalis


Alignment Length:396 Identity:107/396 - (27%)
Similarity:149/396 - (37%) Gaps:109/396 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   314 RTTQASSTSALASASNSVSNASISISNSSS---------GSPS----GRDLSDYGFRIQLGGLAA 365
            |||....|.|.:|......::..|.....|         .|||    ..|:|...:..||..:|.
 Frog     4 RTTTGKMTKAFSSVEWLAQSSRRSHKEQPSKGDQRYSPYPSPSLPSWNSDVSPSSWNSQLSPVAG 68

  Fly   366 AAAAAAATSRQIAAATYARSDTSEELNVDGN-DEDSNDGSHSTPSVCPVDLTRSVNSSAAANPSS 429
            :|..:...    .:|.|: ||:  ||::..| |||         ..|..||.         .||:
 Frog    69 SAQVSPCP----GSAQYS-SDS--ELSLYSNEDED---------LFCEKDLN---------TPST 108

  Fly   430 ASTSASSDRDAATKRLAFSVENILDPNKFTGNKLPSGPFGHPRQWSYERDEEMQERLDDDQSEDM 494
            ...:....||.||             ::::|  :.|.|...||..|               :||.
 Frog   109 PGDNGLLHRDTAT-------------HEYSG--MVSVPANTPRTTS---------------NEDA 143

  Fly   495 SAQDLNDMDQDDMCDDGSDIDDPSSETDSKKGGSRNG----DGKSGGGGGGGSKPRRARTAFTYE 555
            :....:.........:.|.....:.|.|:....|.|.    :||.|         ||.|||||.:
 Frog   144 AKSGYSTSTDSGYESEASRSSSTAPEGDATVSLSPNDTSDEEGKLG---------RRLRTAFTSD 199

  Fly   556 QLVSLENKFKTTRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKK--QNPGMDVNSPTIPPPG 618
            |:.:||..|:..|||...||..||..|.|:|.|:|.||||||.|:|:  |:...|...|      
 Frog   200 QISTLEKTFQKHRYLGASERRKLAAKLQLSEVQIKTWFQNRRMKYKREIQDGRPDSYHP------ 258

  Fly   619 GGSFGPGAYAS--GLLYSHAV--PYPPYGPY-----------FHPLGAHHLSHSHSXNCKM---- 664
            ...||...|:.  ..::.|||  |||.|.|.           .||.....|:|.:| ..:|    
 Frog   259 AQFFGVYGYSQQPTPVFQHAVQQPYPGYSPLMETLPGTMPYAMHPPAMDSLNHFNSPPFQMFYMP 323

  Fly   665 QQRLLQ 670
            ||.|.|
 Frog   324 QQHLGQ 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slouNP_001262808.1 Homeobox 549..601 CDD:278475 28/51 (55%)
ventx2.1NP_988862.1 Homeobox 193..246 CDD:365835 28/52 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.