DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slou and ventx1.2

DIOPT Version :9

Sequence 1:NP_001262808.1 Gene:slou / 42547 FlyBaseID:FBgn0002941 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_988861.1 Gene:ventx1.2 / 394455 XenbaseID:XB-GENE-920868 Length:262 Species:Xenopus tropicalis


Alignment Length:274 Identity:78/274 - (28%)
Similarity:105/274 - (38%) Gaps:70/274 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   447 FSVENILDPNKFTGNKLPSG------------------PFGHPRQWSYERDEEMQERLDDDQ--S 491
            ||::.||..|:   .:.|.|                  |..:.::....:|.:.|..:...|  |
 Frog     6 FSIDLILARNR---EEAPDGKDSVSSRPHIPCAPQPLAPTKYAKEIPRRKDGQEQGEITSFQCSS 67

  Fly   492 ED----------MSAQDLNDMDQDDMCDDGSDIDDPSSETDSKKGGSRNGDGKSGGGGGGGSKPR 546
            |:          :.|...:....|:....||:.|.    |:|....|:..|.:...........|
 Frog    68 EEARNRQFSNPSLPALHRSSGSSDEFSPAGSEDDG----TESSGRNSQENDTEHRSKSPKSDLQR 128

  Fly   547 RARTAFTYEQLVSLENKFKTTRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKK----QNPGM 607
            |.|||||.:|:..||..|...|||...||..||.||.|:|.|||.||||||.|.|:    |.|.|
 Frog   129 RLRTAFTPQQITRLEQAFNKQRYLGASERKKLATSLQLSEIQVKTWFQNRRMKLKRQIQDQQPSM 193

  Fly   608 DVNSPTIPP----PGGGSFGPGAYA----SGLLYSHAVPYPPYGPY------FHPLGAHHLSHSH 658
                  :||    |...|:.||...    ||..|.     ||..|:      |.|...||    |
 Frog   194 ------VPPPVCYPQTFSYYPGGLPVPLNSGSFYQ-----PPAHPFQAPQHSFIPQPLHH----H 243

  Fly   659 SXNCKMQQRLLQLF 672
            . ....|::...||
 Frog   244 MRMSAHQEQFPPLF 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slouNP_001262808.1 Homeobox 549..601 CDD:278475 30/51 (59%)
ventx1.2NP_988861.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 16..129 17/119 (14%)
Homeobox 131..183 CDD:278475 30/51 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.