Sequence 1: | NP_001262808.1 | Gene: | slou / 42547 | FlyBaseID: | FBgn0002941 | Length: | 698 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001139812.1 | Gene: | NKX1-2 / 390010 | HGNCID: | 31652 | Length: | 310 | Species: | Homo sapiens |
Alignment Length: | 292 | Identity: | 111/292 - (38%) |
---|---|---|---|
Similarity: | 140/292 - (47%) | Gaps: | 96/292 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 444 RLAFSVENILDPNKFTGNKLPS-GPFGHPRQWSYERDEEMQERLDDDQSEDMSAQD-LNDMDQDD 506
Fly 507 MCDDGS---------------DIDDP----------------SSETDSKKGGSRNGDGKSGGGGG 540
Fly 541 --------GGS-------------KPRRARTAFTYEQLVSLENKFKTTRYLSVCERLNLALSLSL 584
Fly 585 TETQVKIWFQNRRTKWKKQNPGMDVNSPT---IPPPG----------GGSFGP---GAY------ 627
Fly 628 ---ASGLLYSHAVPYP--------PYGPYFHP 648 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
slou | NP_001262808.1 | Homeobox | 549..601 | CDD:278475 | 48/51 (94%) |
NKX1-2 | NP_001139812.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 36..165 | 25/137 (18%) | |
Homeobox | 167..219 | CDD:278475 | 48/51 (94%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 217..260 | 17/42 (40%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 114 | 1.000 | Domainoid score | I6088 |
eggNOG | 1 | 0.900 | - | - | E1_KOG0488 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0007326 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | LDO | PTHR24340 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2564 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
7 | 6.900 |