DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slou and CG34031

DIOPT Version :9

Sequence 1:NP_001262808.1 Gene:slou / 42547 FlyBaseID:FBgn0002941 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_001246894.1 Gene:CG34031 / 3885665 FlyBaseID:FBgn0054031 Length:219 Species:Drosophila melanogaster


Alignment Length:243 Identity:76/243 - (31%)
Similarity:97/243 - (39%) Gaps:91/243 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   403 GSHSTPSVCPVDLTRSVNSSAAANPSSASTSASSDRDAATKRLAFSVENILDPNKFT---GNKLP 464
            |:.|..|:..   |...:||..:.|...:...|||   .:|..|||         ||   .||.|
  Fly    29 GAFSIDSILS---TSEAHSSQNSLPKDNTNVTSSD---ISKLYAFS---------FTQEGNNKTP 78

  Fly   465 SGPF----GHPRQWSYERDEEMQERLDDDQSEDMSAQDLNDMDQDDMCDDGSDIDD--------- 516
            ...|    ||||            ||                   .:..|||.:..         
  Fly    79 LTNFDLCQGHPR------------RL-------------------PITFDGSTVSRFVWRTESIL 112

  Fly   517 PSSETDS-----KKGGSRNGDGKSGGGGGGGSKPRRARTAFTYEQLVSLENKFKTTRYLSVCERL 576
            ||..|:|     |:...|..|             |:.|.|::..||..|||:|...:||||.:|:
  Fly   113 PSYITNSTNLQEKQLRKRFTD-------------RKPRQAYSASQLERLENEFNLDKYLSVSKRV 164

  Fly   577 NLALSLSLTETQVKIWFQNRRTKWKKQ---------NPGMDVNSPTIP 615
            .|:.||||||.|||.||||||||||||         ..|:.:  ||:|
  Fly   165 ELSKSLSLTEVQVKTWFQNRRTKWKKQLTSRLKIAHRHGLWI--PTLP 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slouNP_001262808.1 Homeobox 549..601 CDD:278475 31/51 (61%)
CG34031NP_001246894.1 Homeobox 136..189 CDD:278475 31/52 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E1_KOG0488
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.