DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slou and lms

DIOPT Version :9

Sequence 1:NP_001262808.1 Gene:slou / 42547 FlyBaseID:FBgn0002941 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_001286635.1 Gene:lms / 37322 FlyBaseID:FBgn0034520 Length:378 Species:Drosophila melanogaster


Alignment Length:236 Identity:75/236 - (31%)
Similarity:98/236 - (41%) Gaps:78/236 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   470 HPRQWSYER---DEEMQERLD-DDQSEDMSAQDLNDMDQ------------DDMCDDG-SDIDDP 517
            :|..:|.|:   ..||:.... :|..:|.|.:..|.:..            ||..||| ||||..
  Fly    10 YPHSFSIEQILAKPEMRSSTSFEDSVQDESGRGGNCLGASRASSPATSSCLDDNMDDGKSDIDLA 74

  Fly   518 SSETDSKKGGSRNGDGKSGGGGGGGSKPRRARTAFTYEQLVSLENKFKTTRYLSVCERLNLALSL 582
            |.:                |.|.|..:.:|.||||:..|:.:||.:|:..:||||.:|..||..|
  Fly    75 SDD----------------GNGLGDDRKKRPRTAFSAAQIKALETEFERGKYLSVAKRTALAKQL 123

  Fly   583 SLTETQVKIWFQNRRTKWKKQNPGMDV------------------------------NSPTIPPP 617
            .|||||:||||||||||||::... ||                              .:||.|.|
  Fly   124 QLTETQIKIWFQNRRTKWKRKYTS-DVETLASHYYAQLGIGGLARPMVVGDRLWLFSQTPTGPTP 187

  Fly   618 -------GGGSFGPGAYASGLLYSHAVPY------PPY-GP 644
                   |.||..|.|.|:....|...||      ||. ||
  Fly   188 IQSIMLNGSGSAAPMASATTATGSPMRPYATSGGMPPLPGP 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slouNP_001262808.1 Homeobox 549..601 CDD:278475 31/51 (61%)
lmsNP_001286635.1 Cnd2 33..>106 CDD:303063 25/88 (28%)
Homeobox 89..142 CDD:278475 31/52 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.