DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slou and Hlx

DIOPT Version :9

Sequence 1:NP_001262808.1 Gene:slou / 42547 FlyBaseID:FBgn0002941 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_001071142.1 Gene:Hlx / 364069 RGDID:1311961 Length:476 Species:Rattus norvegicus


Alignment Length:409 Identity:91/409 - (22%)
Similarity:128/409 - (31%) Gaps:155/409 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 HPHPSAVFHLRAPSSSSTAPPSPATSPLSPPTSPAMHSDQQMSPPIAP-----PQNPPHSSQPPQ 290
            |||.|.....|:|     ..|:|..:|...|..    ..|::||..|.     ||.||...|.||
  Rat    79 HPHASFQAAARSP-----LRPTPVVAPSEVPAG----FPQRLSPLSAAYHQHLPQQPPTQQQQPQ 134

  Fly   291 QQQVAAPSDMDLERIKLVAAVAARTTQASSTSALASASNSVSNASISISNSSSGSPSGRDLSDYG 355
            ||....|                   :|.|.....|.:..|.:.|     .|:.:||.:||.   
  Rat   135 QQPPPPP-------------------RAGSLQPPTSGTRVVPHHS-----GSAPAPSSKDLK--- 172

  Fly   356 FRIQLGGLAAAAAAAAATSRQIAAATYARSDTSEELNVDGNDEDSNDGSHSTPSVCPVDLTRSVN 420
            |.|.                :|.:|.:              |....:|:...      |||..:.
  Rat   173 FGID----------------RILSAEF--------------DPKVKEGNTLR------DLTSLLT 201

  Fly   421 SS-------AAANPSSASTSASSD--RDAATKRLAFSVENILDPNKFTGNKLPSGPFGHPRQWSY 476
            ..       |...||:....||.|  .:|:.         ||.|       |.|.|         
  Rat   202 GGRPTGVHLAGLQPSAGQFFASLDPISEASA---------ILSP-------LSSNP--------- 241

  Fly   477 ERDEEMQERLDDDQSEDMSAQDLNDMDQDDMCDDGSDIDDPSSETDSKKGGSRNGDGKSGGGGGG 541
              ...:|.:..|......:....:.|.|.                                    
  Rat   242 --RNSVQHQFQDTFPGPYAVLTKDTMPQT------------------------------------ 268

  Fly   542 GSKPRR--ARTAFTYEQLVSLENKFKTTRYLSVCERLNLALSLSLTETQVKIWFQNRRTKW---K 601
             .|.:|  :|..|:..|...||.:|:..:|::..:|..||..|.||:.|||:||||||.||   |
  Rat   269 -YKRKRSWSRAVFSNLQRKGLEKRFEIQKYVTKPDRKQLAAMLGLTDAQVKVWFQNRRMKWRHSK 332

  Fly   602 KQNPGMDVNSPTIPPPGGG 620
            :.....|.:......|.||
  Rat   333 EAQAQKDKDKEAGEKPSGG 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slouNP_001262808.1 Homeobox 549..601 CDD:278475 24/54 (44%)
HlxNP_001071142.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 121..170 18/72 (25%)
COG5576 224..>341 CDD:227863 40/180 (22%)
Homeobox 276..330 CDD:395001 24/53 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 328..401 6/24 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 413..476
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.