DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slou and eve

DIOPT Version :9

Sequence 1:NP_001262808.1 Gene:slou / 42547 FlyBaseID:FBgn0002941 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_523670.2 Gene:eve / 36039 FlyBaseID:FBgn0000606 Length:376 Species:Drosophila melanogaster


Alignment Length:157 Identity:50/157 - (31%)
Similarity:71/157 - (45%) Gaps:17/157 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   498 DLNDMDQDDMCDD------GSDIDDPSSETDSKKGGSRNGDGKSGGGGGGGSKPRRARTAFTYEQ 556
            |.:.:||..:..|      |.....|.|..:.......:.:|..|.........||.|||||.:|
  Fly    17 DASPVDQKPLVVDLLATQYGKPQTPPPSPNECLSSPDNSLNGSRGSEIPADPSVRRYRTAFTRDQ 81

  Fly   557 LVSLENKFKTTRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQNPGMDVNSPTIPPPGGGS 621
            |..||.:|....|:|...|..||..|:|.|:.:|:||||||.|.|:|.       ..:..|....
  Fly    82 LGRLEKEFYKENYVSRPRRCELAAQLNLPESTIKVWFQNRRMKDKRQR-------IAVAWPYAAV 139

  Fly   622 FGPGAYASGLLYSHA----VPYPPYGP 644
            :...|:|:.:|.:.|    :|||||.|
  Fly   140 YSDPAFAASILQAAANSVGMPYPPYAP 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slouNP_001262808.1 Homeobox 549..601 CDD:278475 26/51 (51%)
eveNP_523670.2 Homeobox 74..126 CDD:278475 26/51 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D858478at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.