DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slou and pnx

DIOPT Version :9

Sequence 1:NP_001262808.1 Gene:slou / 42547 FlyBaseID:FBgn0002941 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_840087.1 Gene:pnx / 352939 ZFINID:ZDB-GENE-030328-42 Length:182 Species:Danio rerio


Alignment Length:238 Identity:67/238 - (28%)
Similarity:98/238 - (41%) Gaps:77/238 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   444 RLAFSVENILDPNKFTGNKLPSGPFGHPRQWSYERDEEMQERLDDDQSEDMSAQDLNDMDQDDMC 508
            :.:||:.:||||.||.|.:                  |.:|..::.:|...:             
Zfish    13 KTSFSIADILDPAKFNGTR------------------ETREISNNRESPKTT------------- 46

  Fly   509 DDGSDIDDPSSETDSKKGGSRNGDGKSGGGGGGGSKPRRARTAFTYEQLVSLENKFKTTRYLSVC 573
               |...:||:...:....::             .|.:|.|||||.:||..||..|:::.||||.
Zfish    47 ---SPTQEPSAPNIANASAAK-------------VKSKRIRTAFTLDQLRILERSFQSSHYLSVF 95

  Fly   574 ERLNLALSLSLTETQVKIWFQNRRTKWKKQNPGMDVNSPTIPPPGGGSFGPGAYASGLLYSHAVP 638
            ||..:|.:|.|:|||||||||||||||||:..|          .||..           .||..|
Zfish    96 ERHCIASALGLSETQVKIWFQNRRTKWKKELDG----------HGGEE-----------QSHCAP 139

  Fly   639 YP-PYGPYFHPLGAHHLSH--------SHSXNCKMQQRLLQLF 672
            .. ...|..:.|..||.:|        :|..|.....::|.::
Zfish   140 TALTQNPIMYALPGHHANHHVHYYPQQTHYLNTSFHPQMLMMY 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slouNP_001262808.1 Homeobox 549..601 CDD:278475 33/51 (65%)
pnxNP_840087.1 Important for interaction with tle3a. /evidence=ECO:0000269|PubMed:12642490 1..34 10/38 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..63 10/72 (14%)
Homeobox 71..123 CDD:278475 33/51 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576031
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24340
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.