DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slou and scro

DIOPT Version :9

Sequence 1:NP_001262808.1 Gene:slou / 42547 FlyBaseID:FBgn0002941 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_001015473.1 Gene:scro / 3355151 FlyBaseID:FBgn0287186 Length:468 Species:Drosophila melanogaster


Alignment Length:343 Identity:87/343 - (25%)
Similarity:130/343 - (37%) Gaps:87/343 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 QQQVAAPSDMDLERIKLVAAVAARTT---QASSTSALASASNSVSNASISISNSSSGSPSGRDLS 352
            |..|.||::.|     ||.:::.:.|   .|.|.......|..::....|..|:.|         
  Fly    26 QYFVTAPNEED-----LVMSLSPKDTLIHTAISQHHQVDTSTKLNTNETSTQNTVS--------- 76

  Fly   353 DYGFRIQLGGLAAAAAAAAATSRQIAAATYARSDTSEELNVDGNDEDSNDGSHSTP-----SVCP 412
                       .|||||.|.....:::..:.::..|:..:...|      .:||||     .:.|
  Fly    77 -----------TAAAAAVAHHHHNLSSIHHLQNLHSQHQSTLFN------SNHSTPFSVTDILSP 124

  Fly   413 VD-----LTRSVNSSAAANPSSASTSASSDRDAATKRLAFSVENILDPNKFTGNKLPSGPFGH-P 471
            ::     |..:.|..:....:|:|:|.:|.....|..:|              |....|...| |
  Fly   125 IEESYRKLELNGNPPSPFRSNSSSSSINSPGTLTTSTMA--------------NPYAMGTLYHSP 175

  Fly   472 RQWSYERDEEMQERLDDDQSEDMS-AQDLNDMDQDDMCDDGSDIDDPSSETDSKKGGSRNGDGKS 535
            ...:|           ...::::| |....|| ::.....||..:||..........|.:|....
  Fly   176 GVQTY-----------CGPTDNLSLAGHYTDM-RNSASWYGSTANDPRFAISRLMSSSASGTMSH 228

  Fly   536 GGGGGG-------GSKP--------RRARTAFTYEQLVSLENKFKTTRYLSVCERLNLALSLSLT 585
            .|...|       .|||        |:.|..||..|:..||.:||..||||..||.:||..:.||
  Fly   229 MGNMSGLAACSVSDSKPLQFPLAQRRKRRVLFTQAQVYELERRFKQQRYLSAPEREHLASLIHLT 293

  Fly   586 ETQVKIWFQNRRTKWKKQ 603
            .|||||||||.|.|.|:|
  Fly   294 PTQVKIWFQNHRYKCKRQ 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slouNP_001262808.1 Homeobox 549..601 CDD:278475 29/51 (57%)
scroNP_001015473.1 Homeobox 256..309 CDD:278475 29/52 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442252
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24340
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.