DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slou and HOXD4

DIOPT Version :10

Sequence 1:NP_001262808.1 Gene:slou / 42547 FlyBaseID:FBgn0002941 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_055436.2 Gene:HOXD4 / 3233 HGNCID:5138 Length:255 Species:Homo sapiens


Alignment Length:63 Identity:32/63 - (50%)
Similarity:47/63 - (74%) Gaps:0/63 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   542 GSKPRRARTAFTYEQLVSLENKFKTTRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQN 604
            |.:|:|:|||:|.:|::.||.:|...|||:...|:.:|.:|.|:|.|:||||||||.||||.:
Human   151 GGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQIKIWFQNRRMKWKKDH 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slouNP_001262808.1 Homeodomain 546..602 CDD:459649 28/55 (51%)
HOXD4NP_055436.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..127
Antp-type hexapeptide 133..138
Homeodomain 155..211 CDD:459649 28/55 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..255 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.