DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slou and TLX3

DIOPT Version :10

Sequence 1:NP_001262808.1 Gene:slou / 42547 FlyBaseID:FBgn0002941 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_066305.2 Gene:TLX3 / 30012 HGNCID:13532 Length:291 Species:Homo sapiens


Alignment Length:60 Identity:30/60 - (50%)
Similarity:42/60 - (70%) Gaps:0/60 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   544 KPRRARTAFTYEQLVSLENKFKTTRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQ 603
            |.::.||:|:..|:..||.:|...:||:..||..||.||.:|:.|||.|||||||||::|
Human   165 KRKKPRTSFSRVQICELEKRFHRQKYLASAERAALAKSLKMTDAQVKTWFQNRRTKWRRQ 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slouNP_001262808.1 Homeodomain 546..602 CDD:459649 28/55 (51%)
TLX3NP_066305.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..56
Homeodomain 167..223 CDD:459649 28/55 (51%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.