DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slou and Nkx1-2

DIOPT Version :9

Sequence 1:NP_001262808.1 Gene:slou / 42547 FlyBaseID:FBgn0002941 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_001163947.1 Gene:Nkx1-2 / 293568 RGDID:1306744 Length:305 Species:Rattus norvegicus


Alignment Length:297 Identity:110/297 - (37%)
Similarity:135/297 - (45%) Gaps:94/297 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   444 RLAFSVENILDPNKFTGNKLPSGPFGHPRQWSYERDEEMQERLDDDQSED-MSAQDLNDMDQDDM 507
            :::|||.:||||.|||...||.     .|..:.|..:.:   ::.:..|| .|...:...:..|.
  Rat    17 KISFSVLDILDPQKFTRAALPP-----VRLAALEAKKSL---VEVEAGEDACSGNPIGSQETPDA 73

  Fly   508 CDDGSDIDDP--SSETDSKK-----------------------------GGSRNG-DGKSGGGGG 540
            ...|:|...|  .||.:.::                             |...:| ||.....|.
  Rat    74 VGGGTDPASPVEGSEAEEEEEAEDAGRAQRPERWQGAHAGSLEAGAVAVGTEESGADGLPASPGS 138

  Fly   541 GGS-------------KPRRARTAFTYEQLVSLENKFKTTRYLSVCERLNLALSLSLTETQVKIW 592
            .||             |||||||||||||||:|||||:.||||||||||||||||||||||||||
  Rat   139 PGSPRPRRRRAESSCAKPRRARTAFTYEQLVALENKFRATRYLSVCERLNLALSLSLTETQVKIW 203

  Fly   593 FQNRRTKWKKQNPGMD-----------VNSPTIPPPGGGSFG--------PGAY---------AS 629
            ||||||||||||||.|           ..:|.....||||..        |||.         |:
  Rat   204 FQNRRTKWKKQNPGADGAVQAGGSAPQPGTPNAVTGGGGSATGSSPGPPVPGALPFQTFPTYPAT 268

  Fly   630 GLLYSHA----------VPYPPY--GPYFHPLGAHHL 654
            .:|:..|          .|:.|:  .||..|..|.||
  Rat   269 NVLFPAASFPLTTTATGSPFTPFLGPPYLTPFYAPHL 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slouNP_001262808.1 Homeobox 549..601 CDD:278475 48/51 (94%)
Nkx1-2NP_001163947.1 Homeobox 160..213 CDD:395001 49/52 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 114 1.000 Domainoid score I5923
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007326
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24340
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.870

Return to query results.
Submit another query.