DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slou and VENTX

DIOPT Version :9

Sequence 1:NP_001262808.1 Gene:slou / 42547 FlyBaseID:FBgn0002941 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_055283.1 Gene:VENTX / 27287 HGNCID:13639 Length:258 Species:Homo sapiens


Alignment Length:198 Identity:59/198 - (29%)
Similarity:82/198 - (41%) Gaps:31/198 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   515 DDPSSETDSKKGGSRNGDGKSGGGGGGGSKPR-----RARTAFTYEQLVSLENKFKTTRYLSVCE 574
            :.|.:.:..:..||.|.........|...:|.     |.|||||.||:.:||..|:..:|||..|
Human    56 EPPQAVSIKEAAGSSNLPAPERTMAGLSKEPNTLRAPRVRTAFTMEQVRTLEGVFQHHQYLSPLE 120

  Fly   575 RLNLALSLSLTETQVKIWFQNRRTKWKKQNPGMDVNSPTIPPPGGGSF-GPGAY---ASGLLYSH 635
            |..||..:.|:|.|:|.||||||.|.|:|     :..|.:..|..||. .|.|:   :|||....
Human   121 RKRLAREMQLSEVQIKTWFQNRRMKHKRQ-----MQDPQLHSPFSGSLHAPPAFYSTSSGLANGL 180

  Fly   636 AVPYPPYGPYFHPLGAHHLSHSHSXNCKMQQRLLQLFEKRGRAVAG-------------GAGPAA 687
            .: ..|:.|...|........|....|::.|..|   ...|.:..|             ..|||.
Human   181 QL-LCPWAPLSGPQALMLPPGSFWGLCQVAQEAL---ASAGASCCGQPLASHPPTPGRPSLGPAL 241

  Fly   688 GSG 690
            .:|
Human   242 STG 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slouNP_001262808.1 Homeobox 549..601 CDD:278475 28/51 (55%)
VENTXNP_055283.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..93 6/36 (17%)
Homeobox 95..147 CDD:306543 28/51 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 227..248 4/18 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.