DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slou and Nkx1-2

DIOPT Version :9

Sequence 1:NP_001262808.1 Gene:slou / 42547 FlyBaseID:FBgn0002941 Length:698 Species:Drosophila melanogaster
Sequence 2:NP_033149.1 Gene:Nkx1-2 / 20231 MGIID:104806 Length:305 Species:Mus musculus


Alignment Length:297 Identity:110/297 - (37%)
Similarity:136/297 - (45%) Gaps:94/297 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   444 RLAFSVENILDPNKFTGNKLP-----------------------SG-PFGHPRQWSYERDEEMQE 484
            :::|||.:||||.|||...||                       || |.|     |.|..:.:..
Mouse    17 KISFSVLDILDPQKFTRAALPPVRLAALEAKKSLEEVEAGQDACSGNPIG-----SQETPDAVGR 76

  Fly   485 RLD-------DDQSEDMSAQDLNDMDQDDMCDDGSDIDDPSSETDSKKGGSR--NGDGKSGGGGG 540
            .:|       .:..|:..|:|.....|.:.   ...:.:.|.|..:...|:.  ..:|.....|.
Mouse    77 GIDPGSPVEGSEAEEEEEAEDAGRAHQPER---WQGVHEGSPEARAVAVGTEESGAEGLPASPGS 138

  Fly   541 GGS-------------KPRRARTAFTYEQLVSLENKFKTTRYLSVCERLNLALSLSLTETQVKIW 592
            .||             |||||||||||||||:|||||:.||||||||||||||||||||||||||
Mouse   139 PGSPRPRRRRAESSCAKPRRARTAFTYEQLVALENKFRATRYLSVCERLNLALSLSLTETQVKIW 203

  Fly   593 FQNRRTKWKKQNPGMD-----------VNSPTIPPPGGGSFG--------PGAY---------AS 629
            ||||||||||||||.|           ..:|.....||||..        |||.         |:
Mouse   204 FQNRRTKWKKQNPGADGAVQAGGGAPQPGTPGAVAGGGGSATGSSPGPPVPGALPYQTFPTYPAT 268

  Fly   630 GLLY----------SHAVPYPPY-GP-YFHPLGAHHL 654
            .:|:          ::..|:.|: || |..|..|.||
Mouse   269 NVLFPAASFPLTTAANGSPFTPFLGPSYLTPFYAPHL 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slouNP_001262808.1 Homeobox 549..601 CDD:278475 48/51 (94%)
Nkx1-2NP_033149.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..158 20/114 (18%)
Homeobox 160..212 CDD:278475 48/51 (94%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..257 16/46 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 114 1.000 Domainoid score I6073
eggNOG 1 0.900 - - E1_KOG0488
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007326
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24340
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2564
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.900

Return to query results.
Submit another query.